Daily Hints for Today's Puzzles

Popular Tools

Anagram SolverAI Anagram SolverAI Word Problem SolverBoard SolverHangman SolverCryptogram SolverScrabble Word FinderCrossword SolverWordle SolverName Anagram GeneratorEmoji TranslatorPhrase UnscramblerWordscapes SolverWordscapes Answers

NYT Games

WordleConnectionsStrandsSpelling Bee

LinkedIn Games

PinpointCrossclimb

Apple Arcade

Crossword Jam+Wurdweb

Tools

AI Anagram SolverAI Word Problem SolverBoard SolverHangman SolverCryptogram SolverAnagram Circle SolverName Anagram GeneratorFunny Anagram GeneratorEmoji TranslatorPhrase UnscramblerWord Search MakerScrabble CalculatorWord CounterInteractive Letter BankProgressive Hint HelperWaffle Solver

Word Lists

5 Letter WordsBrowse DictionaryAll Word Lists
View all tools and word lists →

Prompt

/pɹɒmpt/

Scrabble:12 ptsWWF:15 pts6 letters
Definition of Prompt

noun

  1. A reminder or cue.
  2. A time limit given for payment of an account for produce purchased, this limit varying with different goods.
  3. A sequence of characters that appears on a monitor to indicate that the computer is ready to receive input.

    "I filled in my name where the prompt appeared on the computer screen but my account wasn't recognized."

  4. (writing) A suggestion for inspiration given to an author.

verb

  1. To lead (someone) toward what they should say or do.

    "I prompted him to get a new job."

  2. To show or tell an actor/person the words they should be saying, or actions they should be doing.

    "If he forgets his words I will prompt him."

  3. To initiate; to cause or lead to.

adjective

  1. Quick; acting without delay.

    "He was very prompt at getting a new job."

  2. On time; punctual.

    "Be prompt for your appointment."

  3. Ready; willing to act.
Anagrams of Prompt

No exact anagrams found for "prompt". This word has a unique letter combination.

+1 Letter Anagrams

Words formed by adding one letter to "prompt" and rearranging:

+sprompts
Related Word Patterns
PR...Words starting with "pr"...PTWords ending with "pt"All 6-letter wordsUnscramble "prompt"
Synonyms & Antonyms
Letter Values
p3
r1
o1
m3
p3
t1

Total: 12 Scrabble points

Word Tools
Find Anagrams of "prompt"All 6-Letter WordsWords Starting With "P"
Rhymes With Prompt
abruptacceptadaptadeptadoptadscriptaptattemptbackdroptbacksweptbankruptbeleapt
Related 6-Letter Words
pablumpacerspachaspacierpacifypacingpackedpackerpacketpacklypadaukpaddedpadderpaddlepadles

Word Validity & Sources

SOWPODS (International Scrabble): Valid
TWL (US/Canada Scrabble): Valid
Words With Friends: Valid
Last verified: December 2024

Dictionary data sourced from SOWPODS (178,691 words), combining TWL (Tournament Word List) and the Collins Scrabble Words dictionary. Definitions from Free Dictionary API and Wordnik.

About the Word "Prompt"

Prompt is a 6-letter word that scores 12 points in Scrabble and 15 points in Words With Friends.

Using "Prompt" in Word Games

When playing Scrabble or Words With Friends, "prompt" is a medium-scoring word.